PDB entry 1uhe

View 1uhe on RCSB PDB site
Description: Crystal structure of aspartate decarboxylase, isoaspargine complex
Class: lyase
Keywords: double-psi beta barrel, LYASE
Deposited on 2003-07-01, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.206
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate 1-decarboxylase alpha chain
    Species: Helicobacter pylori [TaxId:210]
    Gene: PAND
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56065 (0-91)
      • cloning artifact (92-96)
    Domains in SCOPe 2.08: d1uhe.1
  • Chain 'B':
    Compound: Aspartate 1-decarboxylase beta chain
    Species: Helicobacter pylori [TaxId:210]
    Gene: PAND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uhe.1
  • Heterogens: NSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uheA (A:)
    itidedlaklaklregmkveivdvnngerfstyvilgkkrgeicvngaaarkvaigdvvi
    ilayasmnedeinahkpsivlvdekneilekglehhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uheB (B:)
    mtfemlyskihratitdanlnyig