PDB entry 1uhc

View 1uhc on RCSB PDB site
Description: Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]
Class: structural genomics, unknown function
Keywords: beta barrel, SH3, human cDNA, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-06-28, released 2003-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1010 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hj05262
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)
    Domains in SCOPe 2.08: d1uhca1, d1uhca2, d1uhca3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uhcA (A:)
gssgssgseaegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngk
kgyvpsnyirktesgpssg