PDB entry 1uha

View 1uha on RCSB PDB site
Description: Crystal Structure of Pokeweed Lectin-D2
Class: sugar binding protein
Keywords: lectin, chitin-binding domain, SUGAR BINDING PROTEIN
Deposited on 2003-06-27, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin-D2
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uhaa1, d1uhaa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhaA (A:)
    apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
    skygwcgysddhcedgcqsqcd