PDB entry 1uh9

View 1uh9 on RCSB PDB site
Description: Crystal structure of rhizopuspepsin at pH 7.0
Class: hydrolase
Keywords: pepsin, aspartic Proteinase, HYDROLASE
Deposited on 2003-06-26, released 2004-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hizopuspepsin I
    Species: Rhizopus microsporus var. chinensis [TaxId:4843]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02016 (0-324)
      • conflict (240)
      • see remark 999 (280)
      • conflict (292)
      • see remark 999 (293)
    Domains in SCOPe 2.08: d1uh9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh9A (A:)
    agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
    nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
    gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
    gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
    sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
    dtflknnyvvfnqgvpevqiapvae