PDB entry 1uh7

View 1uh7 on RCSB PDB site
Description: Crystal structure of rhizopuspepsin at pH 4.6
Class: hydrolase
Keywords: pepsin, aspartic proteinase, HYDROLASE
Deposited on 2003-06-26, released 2004-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.147
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hizopuspepsin I
    Species: Rhizopus microsporus var. chinensis [TaxId:4843]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02016 (0-324)
      • conflict (240)
      • see remark 999 (280)
      • conflict (292)
      • see remark 999 (293)
    Domains in SCOPe 2.07: d1uh7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh7A (A:)
    agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
    nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
    gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
    gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
    sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
    dtflknnyvvfnqgvpevqiapvae