PDB entry 1uh6

View 1uh6 on RCSB PDB site
Description: Solution Structure of the murine ubiquitin-like 5 protein from RIKEN cDNA 0610031K06
Class: Structural genomics, unknown function
Keywords: beta-grasp fold, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-06-25, released 2003-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-like 5
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 0610031K06
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9EPV8 (27-99)
    • cloning artifact (0-26)
  Domains in SCOPe 2.03: d1uh6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uh6A (A:)
  mkgsshhhhhhssgaslvprgsegaatmievvcndrlgkkvrvkcntddtigdlkkliaa
  qtgtrwnkivlkkwytifkdhvslgdyeihdgmnlelyyq