PDB entry 1uh5

View 1uh5 on RCSB PDB site
Description: Crystal Structure of Enoyl-ACP Reductase with Triclosan at 2.2angstroms
Class: oxidoreductase
Keywords: FabI, Triclosan, P.falciparum, Enoyl-ACP reductase, NAD+, oxidoreductase
Deposited on 2003-06-24, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-ACP reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uh5a_
  • Chain 'B':
    Compound: Enoyl-ACP reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uh5b_
  • Heterogens: TCL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uh5A (A:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntn
    qnknrnrhdvhnimnnsgekeekkisasqnytfidyaieysekyaplrqkllstdigsva
    sfllsresraitgqtiyvdnglnimflpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh5A (A:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraataintfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uh5B (B:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntn
    qnknrnrhdvhnimnnsgekeekkisasqnytfidyaieysekyaplrqkllstdigsva
    sfllsresraitgqtiyvdnglnimflpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh5B (B:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraataintfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd