PDB entry 1uh2

View 1uh2 on RCSB PDB site
Description: Thermoactinomyces vulgaris R-47 alpha-amylase/malto-hexaose complex
Class: hydrolase
Keywords: starch binding domain, hydrolase
Deposited on 2003-06-23, released 2004-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase I
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB BAA02471 (0-636)
      • engineered (355)
      • engineered (395)
    Domains in SCOPe 2.06: d1uh2a1, d1uh2a2, d1uh2a3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh2A (A:)
    aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
    vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
    ipnfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgyd
    nslvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnst
    lqtlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytf
    ytwpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrlnaaqy
    vdangnngsdvtnhqiwsefrnavkgvnsnaaiigqywgnanpwtaqgnqwdaatnfdgf
    tqpvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrs
    ggdlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqk
    litirnqypalrtgsfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqls
    mpngstvtdkitghsytvqngmvtvavdghygavlaq