PDB entry 1uh0

View 1uh0 on RCSB PDB site
Description: Crystal structure of jacalin- Me-alpha-GalNAc complex
Class: sugar binding protein
Keywords: All beta sheet protein, Beta-prism I fold, Gal specific, SUGAR BINDING PROTEIN
Deposited on 2003-06-23, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.1
  • Chain 'B':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.1
  • Chain 'C':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.2
  • Chain 'D':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.2
  • Chain 'E':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.3
  • Chain 'F':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.3
  • Chain 'G':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.4
  • Chain 'H':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uh0.4
  • Heterogens: MGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh0A (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uh0B (B:)
    deqsgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh0B (B:)
    sgksqtvivgpwgak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh0C (C:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uh0D (D:)
    deqsgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh0D (D:)
    sgksqtvivgpwgak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh0E (E:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uh0F (F:)
    deqsgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh0F (F:)
    sgksqtvivgpwgak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uh0G (G:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uh0H (H:)
    deqsgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uh0H (H:)
    sgksqtvivgpwgak