PDB entry 1ugy

View 1ugy on RCSB PDB site
Description: Crystal structure of jacalin- mellibiose (Gal-alpha(1-6)-Glc) complex
Class: sugar binding protein
Keywords: All beta sheets protein, Beta-prism I fold, Gal specific, SUGAR BINDING PROTEIN
Deposited on 2003-06-23, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18670 (0-132)
      • see remark 999 (44)
    Domains in SCOPe 2.07: d1ugy.1
  • Chain 'B':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugy.1
  • Chain 'C':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugy.2
  • Chain 'D':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugy.2
  • Chain 'E':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugy.3
  • Chain 'F':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18673 (Start-19)
      • conflict (18)
    Domains in SCOPe 2.07: d1ugy.3
  • Chain 'G':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18670 (0-132)
      • see remark 999 (44)
    Domains in SCOPe 2.07: d1ugy.4
  • Chain 'H':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugy.4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugyA (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ugyB (B:)
    deqsgisqtvivgpwgakss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugyB (B:)
    qsgisqtvivgpwgak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugyC (C:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ugyD (D:)
    deqsgisqtvivgpwgakss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugyD (D:)
    qsgisqtvivgpwgak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugyE (E:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ugyF (F:)
    deqsgisqtvivgpwgakss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugyF (F:)
    qsgisqtvivgpwgakss
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugyG (G:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ugyH (H:)
    deqsgisqtvivgpwgakss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugyH (H:)
    qsgisqtvivgpwgak