PDB entry 1ugx

View 1ugx on RCSB PDB site
Description: Crystal structure of jacalin- Me-alpha-T-antigen (Gal-beta(1-3)-GalNAc-alpha-o-Me) complex
Class: sugar binding protein
Keywords: All beta sheet protein, Beta-prism I fold, Galactose-specific
Deposited on 2003-06-22, released 2003-09-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: agglutinin alpha chain
  Species: Artocarpus integrifolia
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18670 (0-132)
    • see remark 999 (44)
  Domains in SCOP 1.73: d1ugx.1
• Chain 'B':
  Compound: Agglutinin beta-3 chain
  Species: Artocarpus integrifolia
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18673
  Domains in SCOP 1.73: d1ugx.1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ugxA (A:)
  gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
  pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
  gywldyfsmylsl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1ugxB (B:)
  deqsgisqtvivgpwgakvs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ugxB (B:)
  sgisqtvivgpwgak