PDB entry 1ugx

View 1ugx on RCSB PDB site
Description: Crystal structure of jacalin- Me-alpha-T-antigen (Gal-beta(1-3)-GalNAc-alpha-o-Me) complex
Class: sugar binding protein
Keywords: All beta sheet protein, Beta-prism I fold, Galactose-specific, SUGAR BINDING PROTEIN
Deposited on 2003-06-22, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18670 (0-132)
      • see remark 999 (44)
    Domains in SCOPe 2.07: d1ugx.1
  • Chain 'B':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugx.1
  • Heterogens: GAL, MGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugxA (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ugxB (B:)
    deqsgisqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugxB (B:)
    sgisqtvivgpwgak