PDB entry 1ugv

View 1ugv on RCSB PDB site
Description: Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)
Class: protein binding
Keywords: BETA BARREL, Graf Protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-06-20, released 2003-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Olygophrenin-1 like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hg04539
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA1 (7-65)
      • cloning artifact (0-6)
      • cloning artifact (66-71)
    Domains in SCOPe 2.08: d1ugva1, d1ugva2, d1ugva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ugvA (A:)
gssgssgtpfrkakalyackaehdselsftagtvfdnvhpsqepgwlegtlngktglipe
nyveflsgpssg