PDB entry 1ugu

View 1ugu on RCSB PDB site
Description: Crystal structure of PYP E46Q mutant
Class: photosynthesis
Keywords: photorecepter, PHOTOSYNTHESIS
Deposited on 2003-06-19, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.167
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (Start-124)
      • engineered (45)
    Domains in SCOPe 2.07: d1ugua_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uguA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uguA (A:)
    vafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigknff
    kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
    rv