PDB entry 1ugr

View 1ugr on RCSB PDB site
Description: Crystal structure of aT109S mutant of Co-type nitrile hydratase
Deposited on 2003-06-17, released 2004-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-17, with a file datestamp of 2004-06-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ugra_
  • Chain 'B':
    Domains in SCOP 1.69: d1ugrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugrA (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvcslascypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugrB (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt