PDB entry 1ugr

View 1ugr on RCSB PDB site
Description: Crystal structure of aT109S mutant of Co-type nitrile hydratase
Class: lyase
Keywords: mutant, non-corrin cobalt, nitrile, hydration, lyase
Deposited on 2003-06-17, released 2004-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SID2 (0-202)
      • engineered (107)
      • modified residue (109)
      • modified residue (111)
    Domains in SCOPe 2.07: d1ugra_
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugrb_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugrA (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvcslcscypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugrB (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt