PDB entry 1ugq

View 1ugq on RCSB PDB site
Description: Crystal structure of apoenzyme of Co-type nitrile hydratase
Class: lyase
Keywords: apoenzyme, non-corrin cobalt, nitrile, hydration
Deposited on 2003-06-17, released 2004-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Pseudonocardia thermophila
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ugqa_
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Pseudonocardia thermophila
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ugqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugqA (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugqB (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt