PDB entry 1ugo

View 1ugo on RCSB PDB site
Description: Solution structure of the first Murine BAG domain of Bcl2-associated athanogene 5
Class: chaperone
Keywords: TRIPLE HELIX BUNDLE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, CHAPERONE
Deposited on 2003-06-17, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl2-associated athanogene 5
    Species: Mus musculus [TaxId:10090]
    Gene: FANTOM 2 cDNA 4930405J06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CI32 (7-92)
      • expression tag (0-6)
      • expression tag (93-98)
    Domains in SCOPe 2.08: d1ugoa1, d1ugoa2, d1ugoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ugoA (A:)
gssgssgmdmgnqhpsisrlqeiqrevkaiepqvvgfsglsddknykrleriltkqlfei
dsvdtegkgdiqqarkraaqeterllkeleqnasgpssg