PDB entry 1ugn

View 1ugn on RCSB PDB site
Description: Crystal structure of LIR1.02, one of the alleles of LIR1
Class: immune system
Keywords: immunoglobulin-like folds, IMMUNE SYSTEM
Deposited on 2003-06-17, released 2004-08-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukocyte immunoglobulin-like receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NHL6 (0-197)
      • engineered (69)
    Domains in SCOPe 2.01: d1ugna1, d1ugna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ugnA (A:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqf
    pipsitwehtgryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtl
    qcdsqvafdgfilckegedehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsn
    spyewslpsdllellvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugnA (A:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqf
    pipsitwehtgryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtl
    qcdsqvafdgfilckeqclnsssraifsvgpvspsrrwwyrcyaydsnspyewslpsdll
    ellvlg