PDB entry 1ugm

View 1ugm on RCSB PDB site
Description: Crystal Structure of LC3
Deposited on 2003-06-16, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.215
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ugma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ugmA (A:)
    gplgsmpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
    dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyas
    qetfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugmA (A:)
    ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
    kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe