PDB entry 1ugm

View 1ugm on RCSB PDB site
Description: Crystal Structure of LC3
Class: structural protein
Keywords: LC3, autophagy, STRUCTURAL PROTEIN
Deposited on 2003-06-16, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.215
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated proteins 1A/1B light chain 3
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ugmA (A:)
    gplgsmpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
    dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyas
    qetfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugmA (A:)
    ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
    kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe