PDB entry 1ugl

View 1ugl on RCSB PDB site
Description: Solution structure of S8-SP11
Class: plant protein
Keywords: NMR, Male Determinant of self-Incompatibility, defensin-like, SP11, SCR, cysteine-rich, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PLANT PROTEIN
Deposited on 2003-06-16, released 2003-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-locus pollen protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ugla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uglA (A:)
    nlmkrctrgfrklgkcttleeekcktlyprgqctcsdskmnthscdcksc