PDB entry 1ugk

View 1ugk on RCSB PDB site
Description: Solution structure of the first C2 domain of synaptotagmin IV from human fetal brain (KIAA1342)
Class: protein binding
Keywords: BETA SANDWICH, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-06-16, released 2003-12-16
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-16, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin IV
    Species: HOMO SAPIENS
    Gene: Kazusa cDNA fj00418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2B2 (7-131)
      • cloning artifact (0-6)
      • cloning artifact (132-137)
    Domains in SCOP 1.73: d1ugka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugkA (A:)
    gssgssglgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkv
    ktrvlrktldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgiel
    segkmlmnreiisgpssg