PDB entry 1ugk

View 1ugk on RCSB PDB site
Description: solution structure of the first c2 domain of synaptotagmin iv from human fetal brain (kiaa1342)
Deposited on 2003-06-16, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ugka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugkA (A:)
    gssgssglgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkv
    ktrvlrktldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgiel
    segkmlmnreiisgpssg