PDB entry 1ugk

View 1ugk on RCSB PDB site
Description: Solution structure of the first C2 domain of synaptotagmin IV from human fetal brain (KIAA1342)
Class: protein binding
Keywords: BETA SANDWICH, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-06-16, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin IV
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA fj00418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2B2 (7-131)
      • cloning artifact (0-6)
      • cloning artifact (132-137)
    Domains in SCOPe 2.08: d1ugka1, d1ugka2, d1ugka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugkA (A:)
    gssgssglgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkv
    ktrvlrktldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgiel
    segkmlmnreiisgpssg