PDB entry 1ugj

View 1ugj on RCSB PDB site
Description: Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-06-16, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2310057J16 protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2310057J16
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80VC9 (7-134)
    • cloning artifact (0-6)
    • cloning artifact (135-140)
  Domains in SCOPe 2.08: d1ugja1, d1ugja2, d1ugja3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ugjA (A:)
  gssgssgprlykepsaksnkfiihnalshcclagkvnepqknrileeiekskanhflilf
  rdsscqfralytlsgeteelsrlagygprtvtpamvegiykynsdrkrftqipaktmsms
  vdaftiqghlwqskksgpssg