PDB entry 1ugi

View 1ugi on RCSB PDB site
Description: uracil-DNA glycosylase inhibitor protein
Class: hydrolase inhibitor
Keywords: protein mimicry of DNA, protein inhibitor, hydrolase inhibitor
Deposited on 1998-11-04, released 1999-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.222
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugia_
  • Chain 'B':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugib_
  • Chain 'C':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugic_
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugid_
  • Chain 'E':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugie_
  • Chain 'F':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugif_
  • Chain 'G':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugig_
  • Chain 'H':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ugih_
  • Heterogens: SO4, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ugiA (A:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiA (A:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ugiB (B:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiB (B:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ugiC (C:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiC (C:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ugiD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiD (D:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ugiE (E:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiE (E:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ugiF (F:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiF (F:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ugiG (G:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiG (G:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ugiH (H:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ugiH (H:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml