PDB entry 1ugh

View 1ugh on RCSB PDB site
Description: crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA
Class: glycosylase
Keywords: glycosylase, enzyme-inhibitor complex
Deposited on 1999-02-05, released 1999-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (uracil-DNA glycosylase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ughe_
  • Chain 'I':
    Compound: protein (uracil-DNA glycosylase inhibitor)
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ughi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ughE (E:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ughI (I:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml