PDB entry 1ugg

View 1ugg on RCSB PDB site
Description: human carbonic anhydrase II[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)-orthorhombic form
Class: lyase (oxo-acid)
Keywords: lyase (oxo-acid), acetylation, zinc, polymorphism, disease mutation
Deposited on 1996-07-24, released 1997-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene: CAII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-257)
      • engineered (62)
    Domains in SCOPe 2.05: d1ugga_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uggA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk