PDB entry 1ugd

View 1ugd on RCSB PDB site
Description: human carbonic anhydrase II[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)
Class: lyase (oxo-acid)
Keywords: lyase (oxo-acid), acetylation, zinc, polymorphism, disease mutation
Deposited on 1996-07-24, released 1997-01-27
The last revision prior to the SCOP 1.73 freeze date was dated 1997-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: HOMO SAPIENS
    Gene: CAII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-257)
      • engineered (62)
    Domains in SCOP 1.73: d1ugda_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ugdA (A:)
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk