PDB entry 1ug9

View 1ug9 on RCSB PDB site
Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42
Deposited on 2003-06-16, released 2003-12-09
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ug9A (A:)
    etaeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqf
    avsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvt
    fevldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgav
    angyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtae
    alatakaslgtgykkvsksytgewkkylnsldapatsltgalrtqydvslmtvkshedkt
    fpgafiasltipwgqaasaethregyhavwardmyqsvtallaagdeeaaargvewlfty
    qqqpdghfpqtsrvdgtigqngiqldetafpillanqigrtdagfyrnelkpaadylvaa
    gpktpqerweetggyststlasqiaalaaaadiagkngdagsaavyratadewqrstekw
    mfttngpvgdgkyylrisatgnpndgatrdwgngagvhpenavldggflefvrlgvkapa
    dpyvadslaetdasisqetpggrmwhrytydgygekadgspwdgtgigrlwpllsgerge
    yalangqdalpyletmhsaanagymipeqvwdrdeptsyghelgrstgsasplswamaqy
    vrlaagvkagapvetpqnvaaryaagtplsspelsvtapealstadsatavvrgttnaak
    vyvsvngtateapvtdgtfsldvaltgaknkvtvaavaadggtavedrtvlyygsrigal
    sdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwggqais
    hqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsavslla
    vpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweagdpawi
    kewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpmlglqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ug9A (A:)
    taeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqfa
    vsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvtf
    evldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgava
    ngyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtaea
    latakaslgtgykkvsksytgewkkylnsldapatsltgalrtqydvslmtvkshedktf
    pgafiasltipwgqaasaethregyhavwardmyqsvtallaagdeeaaargvewlftyq
    qqpdghfpqtsrvdgtigqngiqldetafpillanqigrtdagfyrnelkpaadylvaag
    pktpqerweetggyststlasqiaalaaaadiagkngdagsaavyratadewqrstekwm
    fttngpvgdgkyylrisatgnpndgatrdwgngagvhpenavldggflefvrlgvkapad
    pyvadslaetdasisqetpggrmwhrytydgygekadgspwdgtgigrlwpllsgergey
    alangqdalpyletmhsaanagymipeqvwdrdeptsyghelgrstgsasplswamaqyv
    rlaagvkagapvetpqnvaaryaagtplsspelsvtapealstadsatavvrgttnaakv
    yvsvngtateapvtdgtfsldvaltgaknkvtvaavaadggtavedrtvlyygsrigals
    dpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwggqaish
    qrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsavsllav
    pearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweagdpawik
    ewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpmlglqp