PDB entry 1ug9

View 1ug9 on RCSB PDB site
Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42
Class: hydrolase
Keywords: alpha-alpha-six-barrels, GH Family 15, hydrolase
Deposited on 2003-06-16, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucodextranase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ug9a1, d1ug9a2, d1ug9a3, d1ug9a4
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ug9A (A:)
    etaeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqf
    avsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvt
    fevldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgav
    angyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtae
    alatakaslgtgykkvsksytgewkkylnsldapatsltgalrtqydvslmtvkshedkt
    fpgafiasltipwgqaasaethregyhavwardmyqsvtallaagdeeaaargvewlfty
    qqqpdghfpqtsrvdgtigqngiqldetafpillanqigrtdagfyrnelkpaadylvaa
    gpktpqerweetggyststlasqiaalaaaadiagkngdagsaavyratadewqrstekw
    mfttngpvgdgkyylrisatgnpndgatrdwgngagvhpenavldggflefvrlgvkapa
    dpyvadslaetdasisqetpggrmwhrytydgygekadgspwdgtgigrlwpllsgerge
    yalangqdalpyletmhsaanagymipeqvwdrdeptsyghelgrstgsasplswamaqy
    vrlaagvkagapvetpqnvaaryaagtplsspelsvtapealstadsatavvrgttnaak
    vyvsvngtateapvtdgtfsldvaltgaknkvtvaavaadggtavedrtvlyygsrigal
    sdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwggqais
    hqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsavslla
    vpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweagdpawi
    kewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpmlglqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ug9A (A:)
    taeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqfa
    vsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvtf
    evldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgava
    ngyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtaea
    latakaslgtgykkvsksytgewkkylnsldapatsltgalrtqydvslmtvkshedktf
    pgafiasltipwgqaasaethregyhavwardmyqsvtallaagdeeaaargvewlftyq
    qqpdghfpqtsrvdgtigqngiqldetafpillanqigrtdagfyrnelkpaadylvaag
    pktpqerweetggyststlasqiaalaaaadiagkngdagsaavyratadewqrstekwm
    fttngpvgdgkyylrisatgnpndgatrdwgngagvhpenavldggflefvrlgvkapad
    pyvadslaetdasisqetpggrmwhrytydgygekadgspwdgtgigrlwpllsgergey
    alangqdalpyletmhsaanagymipeqvwdrdeptsyghelgrstgsasplswamaqyv
    rlaagvkagapvetpqnvaaryaagtplsspelsvtapealstadsatavvrgttnaakv
    yvsvngtateapvtdgtfsldvaltgaknkvtvaavaadggtavedrtvlyygsrigals
    dpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwggqaish
    qrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsavsllav
    pearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweagdpawik
    ewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpmlglqp