PDB entry 1ug8

View 1ug8 on RCSB PDB site
Description: nmr structure of the r3h domain from poly(a)-specific ribonuclease
Deposited on 2003-06-15, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ug8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug8A (A:)
    gssgssgdqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihve
    tletdkkerhiviskvdeeersgpssg