PDB entry 1ug8

View 1ug8 on RCSB PDB site
Description: NMR structure of the R3H domain from Poly(A)-specific Ribonuclease
Class: hydrolase
Keywords: R3H domain, POLY(A)-SPECIFIC 3'-EXORIBONUCLEASE, PARN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, hydrolase
Deposited on 2003-06-15, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Poly(A)-specific Ribonuclease
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1200003I18
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VDG3 (7-80)
    • cloning artifact (0-6)
    • cloning artifact (81-86)
  Domains in SCOPe 2.08: d1ug8a1, d1ug8a2, d1ug8a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ug8A (A:)
  gssgssgdqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihve
  tletdkkerhiviskvdeeersgpssg