PDB entry 1ug7

View 1ug7 on RCSB PDB site
Description: Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
Class: structural genomics, unknown function
Keywords: hypothetical protein FLJ12806, four helical up-and-down bundle, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-06-13, released 2004-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2610208M17Rik protein
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 2610208M17
  Domains in SCOP 1.75: d1ug7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ug7A (A:)
  gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
  efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
  pisgpssg