PDB entry 1ug7

View 1ug7 on RCSB PDB site
Description: solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
Deposited on 2003-06-13, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1ug7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ug7A (A:)
  gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
  efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
  pisgpssg