PDB entry 1ug6

View 1ug6 on RCSB PDB site
Description: Structure of beta-glucosidase at atomic resolution from thermus thermophilus HB8
Class: hydrolase
Keywords: GLUCOSIDASE, ATOMIC RESOLUTION, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2003-06-12, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.122
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glycosidase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ug6a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ug6A (A:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvry
    lppegpatamgwevypeglyhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsal
    wyreriaraqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ug6A (A:)
    naekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedi
    almqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlp
    laleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglr
    nleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffl
    dpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylpp
    egpatamgwevypeglyhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayle
    ahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyr
    eriara