PDB entry 1ug3

View 1ug3 on RCSB PDB site
Description: C-terminal portion of human eIF4GI
Class: translation
Keywords: eif4g, heat repeat, translation
Deposited on 2003-06-11, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.244
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic protein synthesis initiation factor 4G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04637 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ug3a1, d1ug3a2
  • Chain 'B':
    Compound: eukaryotic protein synthesis initiation factor 4G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04637 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ug3b1, d1ug3b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ug3A (A:)
    skaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersai
    arehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqegg
    vpmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqd
    igafvaeqkveytlgeeseapgqralpseelnrqlekllkegssnqrvfdwieanlseqq
    ivsntlvralmtavcysaiifetplrvdvavlkarakllqkylcdeqkelqalyalqalv
    vtleqppnllrmffdalydedvvkedafyswesskdpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ug3A (A:)
    skaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersai
    arehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqegg
    vpmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqd
    igafvaeqkveytlalpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvral
    mtavcysaiifetplrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnll
    rmffdalydedvvkedafyswes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ug3B (B:)
    skaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersai
    arehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqegg
    vpmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqd
    igafvaeqkveytlgeeseapgqralpseelnrqlekllkegssnqrvfdwieanlseqq
    ivsntlvralmtavcysaiifetplrvdvavlkarakllqkylcdeqkelqalyalqalv
    vtleqppnllrmffdalydedvvkedafyswesskdpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ug3B (B:)
    skaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersai
    arehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqegg
    vpmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqd
    igafvaeqkveytlalpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvral
    mtavcysaiifetplrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnll
    rmffdalydedvvkedafyswes