PDB entry 1ug1

View 1ug1 on RCSB PDB site
Description: SH3 domain of Hypothetical protein BAA76854.1
Class: structural genomics, unknown function
Keywords: Structural genomics, SH3 domain, Hypothetical protein BAA76854.1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-06-11, released 2003-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1010 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hj05262
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-91)
    Domains in SCOPe 2.07: d1ug1a1, d1ug1a2, d1ug1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug1A (A:)
    gssgssgasllaryppeklfqaernfnaaqdldvsllegdlvgvikkkdpmgsqnrwlid
    ngvtkgfvyssflkpynprrshsdassgpssg