PDB entry 1ug1

View 1ug1 on RCSB PDB site
Description: SH3 domain of Hypothetical protein BAA76854.1
Class: structural genomics, unknown function
Keywords: Structural genomics, SH3 domain, Hypothetical protein BAA76854.1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-06-11, released 2003-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1010 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hj05262
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6XZF7 (7-84)
    • cloning artifact (0-6)
    • cloning artifact (85-91)
  Domains in SCOPe 2.08: d1ug1a1, d1ug1a2, d1ug1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ug1A (A:)
  gssgssgasllaryppeklfqaernfnaaqdldvsllegdlvgvikkkdpmgsqnrwlid
  ngvtkgfvyssflkpynprrshsdassgpssg