PDB entry 1ug0

View 1ug0 on RCSB PDB site
Description: Solution structure of SURP domain in BAB30904
Class: RNA binding protein
Keywords: NMR, SURP domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-06-11, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor 4
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 5730496N02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CH02 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOP 1.75: d1ug0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug0A (A:)
    gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
    flhdknsreflyyrrkvaeirksgpssg