PDB entry 1ug0

View 1ug0 on RCSB PDB site
Description: Solution structure of SURP domain in BAB30904
Class: RNA binding protein
Keywords: NMR, SURP domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2003-06-11, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor 4
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5730496N02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CH02 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.07: d1ug0a1, d1ug0a2, d1ug0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug0A (A:)
    gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
    flhdknsreflyyrrkvaeirksgpssg