PDB entry 1ufz

View 1ufz on RCSB PDB site
Description: solution structure of hbs1-like domain in hypothetical protein bab28515
Deposited on 2003-06-11, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ufza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufzA (A:)
    gssgssgeygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailk
    hkfdvqkalsvvleqdgsgpssg