SCOPe 2.05: Structural Classification of Proteins

PDB entry 1ufy

View 1ufy on RCSB PDB site
Description: Crystal analysis of chorismate mutase from thermus thermophilus
Class: isomerase
Keywords: CHORISMATE MUTASE, SHIKIMATE PATHWAY, MUTANT, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-06-11, released 2003-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.11
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: chorismate mutase
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q84FH6 (0-End)
Domains in SCOPe 2.05: d1ufya_
Heterogens: CL, MLI, MES, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1ufyA (A:)
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
aq

Sequence, based on observed residues (ATOM records): (download)

>1ufyA (A:)
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
a