PDB entry 1ufx

View 1ufx on RCSB PDB site
Description: Solution structure of the third PDZ domain of human KIAA1526 protein
Class: protein binding
Keywords: PDZ domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-06-10, released 2003-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1526 Protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fj04743
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P202 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.07: d1ufxa1, d1ufxa2, d1ufxa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufxA (A:)
    gssgssgtlvrvkksaatlgiaieggantrqplprivtiqrggsahncgqlkvghvilev
    ngltlrgkehreaariiaeafktkdrdyidflvtefnsgpssg