PDB entry 1ufv

View 1ufv on RCSB PDB site
Description: Crystal Structure Of Pantothenate Synthetase From Thermus Thermophilus HB8
Class: ligase
Keywords: Structural Genomics, Dimer, Domains, Rossmann Fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ligase
Deposited on 2003-06-10, released 2003-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate-beta-alanine ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufva_
  • Chain 'B':
    Compound: Pantoate-beta-alanine ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufvb_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufvA (A:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvasvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufvB (B:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvasvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp