PDB entry 1ufu

View 1ufu on RCSB PDB site
Description: Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2; LIR-1)
Class: immune system
Keywords: Immunoglobulin-like folds, IMMUNE SYSTEM
Deposited on 2003-06-10, released 2004-08-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.232
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin-like transcript 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ufua1, d1ufua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufuA (A:)
    hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
    ipsitwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtlq
    cdsqvafdgfilckegedehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsns
    pyewslpsdllellvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufuA (A:)
    hlpkptlwaepgsvitqgspvtlrcqgtqeyrlyrekktapwitripqelvkkgqfpips
    itwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtlqcds
    qvafdgfilckeclnsssraifsvvwwyrcyaydsnspyewslpsdllell