PDB entry 1ufr

View 1ufr on RCSB PDB site
Description: Crystal Structure of TT1027 from Thermus thermophilus HB8
Deposited on 2003-06-08, released 2003-12-08
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-08, with a file datestamp of 2003-12-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.264
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ufra_
  • Chain 'B':
    Domains in SCOP 1.67: d1ufrb_
  • Chain 'C':
    Domains in SCOP 1.67: d1ufrc_
  • Chain 'D':
    Domains in SCOP 1.67: d1ufrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufrA (A:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrA (A:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
    vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufrB (B:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrB (B:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
    vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ufrC (C:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrC (C:)
    rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
    vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
    lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ufrD (D:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrD (D:)
    rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
    vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
    lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer