PDB entry 1ufr

View 1ufr on RCSB PDB site
Description: Crystal Structure of TT1027 from Thermus thermophilus HB8
Class: RNA binding protein
Keywords: pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein, uracil phosphoribosyltransferase, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2003-06-08, released 2003-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.264
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyr mRNA-binding attenuation protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufra_
  • Chain 'B':
    Compound: pyr mRNA-binding attenuation protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufrb_
  • Chain 'C':
    Compound: pyr mRNA-binding attenuation protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufrc_
  • Chain 'D':
    Compound: pyr mRNA-binding attenuation protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufrd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufrA (A:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrA (A:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
    vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufrB (B:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrB (B:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
    vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ufrC (C:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrC (C:)
    rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
    vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
    lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ufrD (D:)
    mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
    evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
    dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwereg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufrD (D:)
    rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
    vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
    lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer