PDB entry 1ufq

View 1ufq on RCSB PDB site
Description: Crystal structure of ligand-free human uridine-cytidine kinase 2
Class: transferase
Keywords: ALPHA/BETA MONONUCLEOTIDE-BINDING HOLD, transferase
Deposited on 2003-06-06, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufqa_
  • Chain 'B':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufqb_
  • Chain 'C':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufqc_
  • Chain 'D':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufqA (A:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufqA (A:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdiln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufqB (B:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufqB (B:)
    epfligvsggtasgkssvcakivqllgqnrqkqvvilsqdsfyrvltseqkakalkgqfn
    fdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafys
    qevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkk
    yadviiprgadnlvainlivqhiqdiln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ufqC (C:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufqC (C:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdiln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ufqD (D:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufqD (D:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisgrdleqilsqyitfvkpafeefclpt
    kkyadviiprgadnlvainlivqhiqdiln