PDB entry 1ufn

View 1ufn on RCSB PDB site
Description: solution structure of the sand domain of the putative nuclear protein homolog (5830484a20rik)
Deposited on 2003-06-02, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ufna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ufnA (A:)
  gssgssgndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflnegg
  ratskdwkgvircngetlrhleqkgllfsgpssg